Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bromus secalinus Oleosin 16 kDa(OLE16)

Recombinant Bromus secalinus Oleosin 16 kDa(OLE16)

SKU:CSB-CF846557BMK

Regular price £1,237.00 GBP
Regular price Sale price £1,237.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bromus secalinus (Rye brome)

Uniprot NO.:Q96543

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ADHHRDRGVLGGGALGERGSHGGYGYTGDHGGYGGDDEQHQQKQPVMMCALKAATAATAG GSMLVLSGLILAGTVIALTVATPVLVIFSPVLVPAAISMALMSAGFVTSGGLGVAAVSVF SWMYKYLAGKHPPGADQLDHAKARLASKARDIKDAAQIRVEQAQGA

Protein Names:Recommended name: Oleosin 16 kDa

Gene Names:Name:OLE16

Expression Region:2-167

Sequence Info:full length protein

View full details