Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bradyrhizobium sp. UPF0059 membrane protein BBta_7389 (BBta_7389)

Recombinant Bradyrhizobium sp. UPF0059 membrane protein BBta_7389 (BBta_7389)

SKU:CSB-CF399585BPE

Regular price £1,272.00 GBP
Regular price Sale price £1,272.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)

Uniprot NO.:A5ESV8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPFAVVLLAFSMSVDAFAVSVGRGAALGRPRYSEALRSGAVFGVVEAITPVIGWVAGVA ASSFVQAVDHWLAFGLLAAVGLHMLYAAVWKKADAKPVGRSFTVLMATAIGTSLDAMAVG VSLAFLNVNIVVVATAIGLATFLMSSGGMLIGRLIGEHFGRIAEAVAGIALFGLGLSILI EHLTA

Protein Names:Recommended name: UPF0059 membrane protein BBta_7389

Gene Names:Ordered Locus Names:BBta_7389

Expression Region:1-185

Sequence Info:full length protein

View full details