Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bradyrhizobium japonicum UPF0314 protein bll0647(bll0647)

Recombinant Bradyrhizobium japonicum UPF0314 protein bll0647(bll0647)

SKU:CSB-CF803762BVW

Regular price £1,276.00 GBP
Regular price Sale price £1,276.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bradyrhizobium japonicum (strain USDA 110)

Uniprot NO.:Q89WN1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLATTHESKAAVPAFAWVSIALLLLALQASILFAMGRVPICTCGYVKLWHGVVNSSENS QHIADWYSFSHVLHGFLFYGLTFLLFARLPLLPLSWPARLIVAMLIEGAWEIVENSPFII ERYRAGTISLDYFGDSIVNSVSDNLAMVLGFLAARVLPVWVTVMIGLAFEIMLALHIRDN LTLNILMLIHPIEAVKQWQSGPPII

Protein Names:Recommended name: UPF0314 protein bll0647

Gene Names:Ordered Locus Names:bll0647

Expression Region:1-205

Sequence Info:full length protein

View full details