Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bradyrhizobium japonicum Heme exporter protein B(cycW)

Recombinant Bradyrhizobium japonicum Heme exporter protein B(cycW)

SKU:CSB-CF330040BVW

Regular price £1,309.00 GBP
Regular price Sale price £1,309.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bradyrhizobium japonicum (strain USDA 110)

Uniprot NO.:P30964

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTALSALIRRDIRIALRVGGGALIGVLFFLTVVVLMPFAVGPDLALLSRLGPAILWLGAL LASLLTLDRLFMADHEDGSLDLITMSRTPLELACAAKALAHWLAAGLPLIVATPVLGLLL NLDMVATGAVALTLLAGTPALTFTGMIGAALAVTLHRGGLLMAVLVLPLSIPVLIFGVAA SQAVIVGPMSFGAPFSILCALSLVSLVIGPFAAAASLRHGLD

Protein Names:Recommended name: Heme exporter protein B Alternative name(s): Cytochrome c-type biogenesis protein CycW

Gene Names:Name:cycW Synonyms:ccmB Ordered Locus Names:blr0468

Expression Region:1-222

Sequence Info:full length protein

View full details