Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Vesicle-associated membrane protein-associated protein B(VAPB)

Recombinant Bovine Vesicle-associated membrane protein-associated protein B(VAPB)

SKU:CSB-CF025790BO

Regular price £1,328.00 GBP
Regular price Sale price £1,328.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A2VDZ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIIPTTASKTETPTVSKALSSSLDDTEVKKVMEECKRLQSEVQRLREENKQFKEEDGLRMRKTAQSNSPAPASAMAGKEEGLSTRLLALVVLFFIVGVIIGKIAL

Protein Names:Recommended name: Vesicle-associated membrane protein-associated protein B Short name= VAMP-B Short name= VAMP-associated protein B Short name= VAP-B

Gene Names:Name:VAPB

Expression Region:2-243

Sequence Info:full length protein

View full details