Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Transmembrane 4 L6 family member 18(TM4SF18)

Recombinant Bovine Transmembrane 4 L6 family member 18(TM4SF18)

SKU:CSB-CF666212BO

Regular price £1,273.00 GBP
Regular price Sale price £1,273.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q3T110

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGSRKCGSCLSSLLIPLALWSIIVNILLYFPNGQASYASSNKLTNYVWYFEGICFSGIMM LVVAAVLLVLENDNNYKCCQSENCSKKYMTVLSMIFSALGIAFSGYCLVISALGLLQGPY CRTLDGWEYAFEGTAGRFLTDSREWIQCLEPAHVVEWNIILFSILIALSGLQVIVCLIRV VIQLSKSLCGTYSVIIQPGII

Protein Names:Recommended name: Transmembrane 4 L6 family member 18

Gene Names:Name:TM4SF18

Expression Region:1-201

Sequence Info:full length protein

View full details