Gene Bio Systems
Recombinant Bovine Short transient receptor potential channel 5(TRPC5)
Recombinant Bovine Short transient receptor potential channel 5(TRPC5)
SKU:CSB-CF889005BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q9MYV9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:FIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFG LLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQL
Protein Names:Recommended name: Short transient receptor potential channel 5 Short name= TrpC5
Gene Names:Name:TRPC5 Synonyms:TRP5
Expression Region:1-109
Sequence Info:full length protein
