Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Resistin(RETN)

Recombinant Bovine Resistin(RETN)

SKU:CSB-EP019573BO

Regular price £891.00 GBP
Regular price Sale price £891.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q762I5

Gene Names: RETN

Organism: Bos taurus (Bovine)

AA Sequence: QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ

Expression Region: 19-109aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 13.6 kDa

Alternative Name(s):

Relevance: Hormone that ses to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes .

Reference: Gene expression of resistin and TNF-alpha in adipose tissue of Japanese Black steers and Holstein steers.Komatsu T., Itoh F., Hodate K., Hazegawa S., Obara Y., Kushibiki S.Anim. Sci. J. 76:567-573(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details