Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Receptor expression-enhancing protein 5(REEP5)

Recombinant Bovine Receptor expression-enhancing protein 5(REEP5)

SKU:CSB-CF640941BO

Regular price £1,256.00 GBP
Regular price Sale price £1,256.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q29RM3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAAMRQRFDQFLHQKNCMTDLLAKTEAKTGVNRSFIALGVIGLLALYLVFGYGASLLCN LIGFGYPAYVSIKAIESPNKEDDTQWLTYWVVYGVFSIVEFFSDLFLSWFPFYYMLKCGF LLWCMAPSPANGADLLYKRIIRPFFLKHESQVDNVVNDLKDKAKETADTISKEARKAAVS LLGEEKKST

Protein Names:Recommended name: Receptor expression-enhancing protein 5

Gene Names:Name:REEP5

Expression Region:1-189

Sequence Info:full length protein

View full details