Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Protein phosphatase 1L(PPM1L)

Recombinant Bovine Protein phosphatase 1L(PPM1L)

SKU:CSB-CF018498BO

Regular price £1,431.00 GBP
Regular price Sale price £1,431.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A5PJZ2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGLDVLEAEFSKTWEFKSHNVAVYSIQGRRDHMEDRFEVLMDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKDRLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ

Protein Names:Recommended name: Protein phosphatase 1L EC= 3.1.3.16 Alternative name(s): Protein phosphatase 1-like Protein phosphatase 2C isoform epsilon Short name= PP2C-epsilon

Gene Names:Name:PPM1L Synonyms:PP2CE

Expression Region:1-360

Sequence Info:full length protein

View full details