Gene Bio Systems
Recombinant Bovine Lens fiber membrane intrinsic protein(LIM2)
Recombinant Bovine Lens fiber membrane intrinsic protein(LIM2)
SKU:CSB-CF012946BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:P20274
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYSFMGGGLFCAWVGTILLVVATATDHWMQYRLSGAFAHQGLWRYCLGTKCYLQTESIAY WNATRAFMILSSLCATSGIIMGIVAFAQQPTFTRLSRPFSAGIMFFASTFFVLLALAIYT GVTVSFLGRRFGDWRFSWSYILGWVALLMTFFAGIFYMCAYRMHECRRLSTPR
Protein Names:Recommended name: Lens fiber membrane intrinsic protein Alternative name(s): MP18 MP19 MP20 MP21 MP23
Gene Names:Name:LIM2
Expression Region:1-173
Sequence Info:Full length protein
