Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Keratinocyte-associated protein 2(KRTCAP2)

Recombinant Bovine Keratinocyte-associated protein 2(KRTCAP2)

SKU:CSB-CF012692BO

Regular price £1,211.00 GBP
Regular price Sale price £1,211.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A6QQ59

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATA PVLTPAKVTGKGKKRN

Protein Names:Recommended name: Keratinocyte-associated protein 2 Short name= KCP-2

Gene Names:Name:KRTCAP2

Expression Region:1-136

Sequence Info:Full length protein

View full details