Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Interferon alpha-inducible protein 27-like protein 2(IFI27L2)

Recombinant Bovine Interferon alpha-inducible protein 27-like protein 2(IFI27L2)

SKU:CSB-CF634523BO-GB

Regular price £1,215.00 GBP
Regular price Sale price £1,215.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q24JY7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AVGFTGAGIAASSLAAKMMSAAAVANGGGVAAGSLVATLQSVGAAGLSTSSNILLGSIGS AFGALLGGAKRASPSPPPGGPRPEGEQPGENVPQVEPPKSPLGPEKHEK

Protein Names:Recommended name: Interferon alpha-inducible protein 27-like protein 2 Alternative name(s): Interferon-stimulated gene 12b protein Short name= ISG12(b)

Gene Names:Name:IFI27L2 Synonyms:FAM14A

Expression Region:25-133

Sequence Info:full length protein

View full details