Gene Bio Systems
Recombinant Bovine Ig-like V-type domain-containing protein FAM187A(FAM187A)
Recombinant Bovine Ig-like V-type domain-containing protein FAM187A(FAM187A)
SKU:CSB-CF008162BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:A7E3C4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:FEIVEKENIFQRTPCPAFLMFDNAAYLTDMSFELPCPCKPEEVSAVVWYYQKHLGSSHTKVLTDFDGRVLTEAAQVRVGSDMLVRFSIRMFSLLVFRAQPEDSGLYFCGTRKGDYFYAYDVDIQSSEGMVATFKDQGQEPLEDEYHGSLRVFTTFWEWTPCDRCGVRGEQWRIGLCYLQSPDLSPRYRKILPNVVSCGSRAVPRQLRAKASDHNPELLVRSCLMPCEKKKKVQEGVMAIFNYVSKVGSRPWLPQVPIQFHQQRLGHGLIISCPGARPEHAVAWDKDHQYLYRTQYLKGVNGSMRVFIDHGNHLHIRFTQLEDRGIYYCWRQGERIAGFRLGVTSPGRYPVSFSDPETRAALGLILIGYMLITVIFISIHLCRCCCYLFRFCPNFSPRLSRPQL
Protein Names:Recommended name: Ig-like V-type domain-containing protein FAM187A
Gene Names:Name:FAM187A
Expression Region:19-421
Sequence Info:full length protein
