Gene Bio Systems
Recombinant Bovine Fibronectin type III domain-containing protein 4(FNDC4)
Recombinant Bovine Fibronectin type III domain-containing protein 4(FNDC4)
SKU:CSB-CF008769BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:A6QPL2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV
Protein Names:Recommended name: Fibronectin type III domain-containing protein 4 Alternative name(s): Fibronectin type III repeat-containing protein 1
Gene Names:Name:FNDC4 Synonyms:FRCP1
Expression Region:41-230
Sequence Info:full length protein
