Recombinant Bovine Dolichol-phosphate mannosyltransferase subunit 3(DPM3)

SKU: CSB-CF671364BO

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q3ZC71

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTKLAQWLWALALLGSTWAALTMGALGLELPSSCREVLWPLPAYLLVSAGCYALGTVGYR VATFHDCEDAARELQSQIQEARADLTRRGLRF

Protein Names:Recommended name: Dolichol-phosphate mannosyltransferase subunit 3 Alternative name(s): DPM synthase complex subunit 3 Dolichol-phosphate mannose synthase subunit 3 Dolichyl-phosphate beta-D-mannosyltransferase subunit 3 Mannose-P-doli

Gene Names:Name:DPM3

Expression Region:1-92

Sequence Info:full length protein