Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Cytochrome c1, heme protein, mitochondrial(CYC1)

Recombinant Bovine Cytochrome c1, heme protein, mitochondrial(CYC1)

SKU:CSB-CF006327BO

Regular price £1,303.00 GBP
Regular price Sale price £1,303.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P00125

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDE AKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRAR HGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMS QVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP K

Protein Names:Recommended name: Cytochrome c1, heme protein, mitochondrial Alternative name(s): Complex III subunit 4 Complex III subunit IV Cytochrome b-c1 complex subunit 4 Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit Short n

Gene Names:Name:CYC1

Expression Region:85-325

Sequence Info:Full length protein

View full details