Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine CD302 antigen(CD302)

Recombinant Bovine CD302 antigen(CD302)

SKU:CSB-CF004923BO

Regular price £1,300.00 GBP
Regular price Sale price £1,300.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A8WH74

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DCPSSTWVQFQDSCYIFLQEAIKVESIEDVRNQCTNHGADMISIHNEEENAFILDTLKKQWKDPADILLGMFFDTDDASFKWFDNSNMTFNKWSDQEDDEELVDTCAFLHTKTGDWKKGNCEVSSVEGTLCKAAIPYEKKYLSDNRILISALVIASTVILTVLGAVVWFLYKRSLDSGFTTVFSAAHQSPYNDDCVLVVAEENEYDIQFN

Protein Names:Recommended name: CD302 antigen Alternative name(s): Type I transmembrane C-type lectin receptor DCL-1

Gene Names:Name:CD302

Expression Region:23-232

Sequence Info:full length protein

View full details