Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Adrenodoxin, mitochondrial(FDX1)

Recombinant Bovine Adrenodoxin, mitochondrial(FDX1)

SKU:CSB-EP008570BO

Regular price £501.00 GBP
Regular price Sale price £501.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Metabolism

Uniprot ID:P00257

Gene Names:FDX1

Organism:Bos taurus (Bovine)

AA Sequence:SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE

Expression Region:59-186aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged

MW:19.5 kDa

Alternative Name(s):Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)

Relevance:Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage to produce pregnenolone, the precursor of most steroid hormones. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons.

Reference:"Molecular cloning and amino acid sequence of the precursor form of bovine adrenodoxin: evidence for a previously unidentified COOH-terminal peptide." Okamura T., John M.E., Zuber M.X., Simpson E.R., Waterman M.R. Proc. Natl. Acad. Sci. U.S.A. 82:5705-5709(1985)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Essential for the synthesis of various steroid hormones, participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage (By similarity).

Involvement in disease:

Subcellular Location:Mitochondrion matrix

Protein Families:Adrenodoxin/putidaredoxin family

Tissue Specificity:Detected in adrenal cortex and corpus luteum (at protein level).

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Bt&CID=1573

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?bta:281157

STRING Database Link:https://string-db.org/network/9913.ENSBTAP00000015660

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details