Skip to product information
1 of 1

Gene Bio Systems

Recombinant Botryotinia fuckeliana Golgi apparatus membrane protein tvp23(tvp23)

Recombinant Botryotinia fuckeliana Golgi apparatus membrane protein tvp23(tvp23)

SKU:CSB-CF411601BVD

Regular price £1,259.00 GBP
Regular price Sale price £1,259.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)

Uniprot NO.:A6SFL7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTCCYETNEMNECSVFECTPTVVASLLVYLFGMLFIKNFVMIFIITILLLAADFYYLKN IAGRRLVGLRWWNEVDPASGDSHWVFESSDPNTKIINPTDSRFFWLALYSQPLLWVGLAF VAIFRFEFIWLTLIVIALSLTVTNTLAFSRCDKFGQASNLAGSAMYSSGIAGNIASATIG RFFSR

Protein Names:Recommended name: Golgi apparatus membrane protein tvp23

Gene Names:Name:tvp23 ORF Names:BC1G_11827

Expression Region:1-185

Sequence Info:full length protein

View full details