Skip to product information
1 of 1

Gene Bio Systems

Recombinant Borrelia burgdorferi Probable protein-export membrane protein SecG(secG)

Recombinant Borrelia burgdorferi Probable protein-export membrane protein SecG(secG)

SKU:CSB-CF528683BUD

Regular price £1,199.00 GBP
Regular price Sale price £1,199.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Uniprot NO.:O51083

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLVRFFIFIIFVIVSIFIILLVLIQDEQGDGIGGVFGGGSSSIFGAKSSSVAVKITGFF IALFFIFVVLLSFLNTRRADDSFLNDIKTENKNSSTFWDDENSESDANINEIKENNLKEK

Protein Names:Recommended name: Probable protein-export membrane protein SecG

Gene Names:Name:secG Ordered Locus Names:BB_0054

Expression Region:1-120

Sequence Info:full length protein

View full details