Gene Bio Systems
Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2(clpP2)
Recombinant Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2(clpP2)
SKU:CSB-EP528713BUD
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: clpP2
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Delivery time: 3-7 business days
Uniprot ID: O51698
AA Sequence: MTGKEDNDACVLHDKSLKLVLKSRSIVIAGEITKDVSRLFQEKILLLEALDFKKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTVGVGLVASAAALIFLAAKLENRFSLPFARYLLHQPLSGFKGVATDIEIYTNELNKVKKELNNIISKETGQKISKIEKDTDRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-198aa
Protein length: Full Length
MW: 27.2 kDa
Alternative Name(s): Endopeptidase Clp 2
Relevance: Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
Reference: "Genomic sequence of a Lyme disease spirochaete, Borrelia burgdorferi." Fraser C.M., Casjens S., Huang W.M., Sutton G.G., Clayton R.A., Lathigra R., White O., Ketchum K.A., Dodson R.J., Hickey E.K., Gwinn M.L., Dougherty B.A., Tomb J.-F., Fleischmann R.D., Richardson D.L., Peterson J.D., Kerlavage A.R., Quackenbush J. Venter J.C. Nature 390:580-586(1997)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.