Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bordetella pertussis Type IV secretion system protein ptlE(ptlE)

Recombinant Bordetella pertussis Type IV secretion system protein ptlE(ptlE)

SKU:CSB-CF746284BUA

Regular price £1,295.00 GBP
Regular price Sale price £1,295.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Uniprot NO.:Q7VSX6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPDPRPLTPDQTHGRGHAEAAVDWEASRLYRLAQSERRAWTVAWAALAVTALSLIAIATM LPLKTTIPYLIEVEKSSGAASVVTQFEPRDFTPDTLMNQYWLTRYVAARERYDWHTIQHD YDYVRLLSAPAVRHDYETSYEAPDAPDRKYGAGTTLAVKILSAIDHGKGVGTVRFVRTRR DADGQGAAESSIWVATVAFAYDQPRALTQAQRWLNPLGFAVTSYRVDAEAGQP

Protein Names:Recommended name: Type IV secretion system protein ptlE Alternative name(s): Pertussis toxin liberation protein E

Gene Names:Name:ptlE Ordered Locus Names:BP3793

Expression Region:1-233

Sequence Info:full length protein

View full details