Skip to product information
1 of 1

Gene Bio Systems

Recombinant BNIP3 homolog(dct-1)

Recombinant BNIP3 homolog(dct-1)

SKU:CSB-CF427999CXX

Regular price £1,309.00 GBP
Regular price Sale price £1,309.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis briggsae

Uniprot NO.:A8XPY4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLDIKKKINFANVSGEKTDESSSSSAQQSSEQQQAAQPLAPQQTTPTAKATNPFITPMTE STPGMSESWVELAPSRTSLCSSVDINMVIIDEKDKDSRLSPVSIAQSPHVEFESLEQVKY KLVREMLPPGKNTDWMWDWSSRPENTPPKTIRMVQYGSNLTTPPNSPEPEMSQYMPYESD SLFNVRVVFGFLVTNIFSFVVGAAVGFAVCRKIIKHHRHY

Protein Names:Recommended name: BNIP3 homolog Short name= CbBNIP3 Alternative name(s): Daf-16/FOXO controlled germline tumor affecting

Gene Names:Name:dct-1 ORF Names:CBG16854

Expression Region:1-220

Sequence Info:full length protein

View full details