Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bifidobacterium longum subsp. infantis UPF0059 membrane protein Blon_0280-BLIJ_0284 (Blon_0280, BLIJ_0284)

Recombinant Bifidobacterium longum subsp. infantis UPF0059 membrane protein Blon_0280-BLIJ_0284 (Blon_0280, BLIJ_0284)

SKU:CSB-CF476171BTB

Regular price £1,279.00 GBP
Regular price Sale price £1,279.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

Uniprot NO.:B7GTW5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIAIIVQTLLISVSVAMDAFAVSIGKGLTVSRVRPGDAVRSALWFGGSQALFLILGHYAA SAFSAYVTAFDHWIIFGLLAFIGGNMVHEAYEEDAENAKETAQFDWKHMLPLAVACSIDA FAVGVSLAFMATSVPFAILCISVVTGLFSAAGLYIGRAFGAHWQKPAQIAGGVVLILIGV KVLLEHLGVIAF

Protein Names:Recommended name: UPF0059 membrane protein Blon_0280/BLIJ_0284

Gene Names:Ordered Locus Names:Blon_0280, BLIJ_0284

Expression Region:1-192

Sequence Info:full length protein

View full details