Gene Bio Systems
Recombinant Berne virus Truncated non-functional hemagglutinin-esterase homolog(HE)
Recombinant Berne virus Truncated non-functional hemagglutinin-esterase homolog(HE)
SKU:CSB-CF329127BGI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Berne virus (BEV)
Uniprot NO.:P31964
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNFTVPVQAIQSIWSVGKESDDAIAEACKPPFCIYFSKKTPYTVTNGSNADHGDDEVRQM MRGLLYNSSCISAQGHTPLALYSTAMLYPPMYGSCPQYVKLFDGSGSESVDVISSSYFVA TWVLLVVVIILVFIIISFCISN
Protein Names:Recommended name: Truncated non-functional hemagglutinin-esterase homolog
Gene Names:Name:HE
Expression Region:1-142
Sequence Info:full length protein
