Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bat coronavirus Rp3-2004 Protein 7a(7a)

Recombinant Bat coronavirus Rp3-2004 Protein 7a(7a)

SKU:CSB-CF663000BFE

Regular price £1,211.00 GBP
Regular price Sale price £1,211.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Uniprot NO.:Q3I5J0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVHQELYSPLFLIVAALVFITLCFTIKRKTE

Protein Names:Recommended name: Protein 7a Alternative name(s): Accessory protein 7a

Gene Names:ORF Names:7a

Expression Region:16-122

Sequence Info:full length protein

View full details