Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bat coronavirus Rp3-2004 Membrane protein(M)

Recombinant Bat coronavirus Rp3-2004 Membrane protein(M)

SKU:CSB-CF666916BFE

Regular price £1,284.00 GBP
Regular price Sale price £1,284.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Uniprot NO.:Q3I5J2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAENGTISVEELKRLLEQWNLVIGFIFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVT LACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLN VPLRGTILTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKL GASQRVGTDSGFAAYNRYRIGNYKLNTDHSGSNDNIALLVQ

Protein Names:Recommended name: Membrane protein Short name= M protein Alternative name(s): E1 glycoprotein Matrix glycoprotein Membrane glycoprotein

Gene Names:Name:M ORF Names:5

Expression Region:1-221

Sequence Info:full length protein

View full details