Recombinant Bat coronavirus 279-2005  Protein 7a(7a)

Recombinant Bat coronavirus 279-2005 Protein 7a(7a)

CSB-CF611307BFB
Regular price
£865.00 GBP
Sale price
£865.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)

Uniprot NO.:Q0Q470

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCISTHFAFACADGTRHTY QLRARSVSPKLFTRQEEVHQELYSPLFLIVAALVFIILCFTIKRKTE

Protein Names:Recommended name: Protein 7a Alternative name(s): Accessory protein 7a

Gene Names:ORF Names:7a

Expression Region:16-122

Sequence Info:full length protein

Your list is ready to share