Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab(cry1Ab),partial

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab(cry1Ab),partial

SKU:CSB-EP363358BDC

Regular price £797.00 GBP
Regular price Sale price £797.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P0A370

Gene Names: cry1Ab

Organism: Bacillus thuringiensis subsp. kurstaki

AA Sequence: HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Expression Region: 1022-1155aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 31.3 kDa

Alternative Name(s): 130KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b)

Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Reference: Characterization of Bacillus thuringiensis subsp. kurstaki strain S93 effective against the Fall armyworm, Spodoptera frugiperda and cloning of a cry1Ab gene.Silva-Werneck J.O., De-Souza M.T., Dias J.M.C.S., Ribeiro B.M.Can. J. Microbiol. 45:464-471(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details