Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis UPF0702 transmembrane protein yrbG(yrbG)

Recombinant Bacillus subtilis UPF0702 transmembrane protein yrbG(yrbG)

SKU:CSB-CF521816BRJ

Regular price £1,282.00 GBP
Regular price Sale price £1,282.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O32050

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEELLTIAFRTVVLYFVILVIFRFMGKREIGELSILDLVVFIMMAEIAVLAIENVDDHLF HTILPMLVLMIIQVTLAYFSLKNRKVRQLLDGKPTIIIKYGKIDEEAMKSQRYNFDDLMV QLRENSIDRVADVSFAILEPSGKLTIVKKENSGEHRQLEMPLIIDGFIQTENLSRISKDR KWLLESLQKHGYTNPSDISFCSFTDGEIYIDEKDGHRT

Protein Names:Recommended name: UPF0702 transmembrane protein yrbG

Gene Names:Name:yrbG Ordered Locus Names:BSU27680

Expression Region:1-218

Sequence Info:full length protein

View full details