Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Uncharacterized protein yczC(yczC)

Recombinant Bacillus subtilis Uncharacterized protein yczC(yczC)

SKU:CSB-CF523257BRJ

Regular price £1,203.00 GBP
Regular price Sale price £1,203.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O31469

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELAGFMLRACALLLDVIIAAAVILAAGFTFGDGSAGVIIVAILMLIVYPLLMPLTNWKG TLGKKIIGLQIVRDETYKKISFPQAIVRYLIAWVHVFSRLIYLTAAFTKKKQTVHDMAAK TIVLKAE

Protein Names:Recommended name: Uncharacterized protein yczC

Gene Names:Name:yczC Ordered Locus Names:BSU02710

Expression Region:1-127

Sequence Info:full length protein

View full details