Gene Bio Systems
Recombinant Bacillus subtilis Uncharacterized protein ybeF(ybeF)
Recombinant Bacillus subtilis Uncharacterized protein ybeF(ybeF)
SKU:CSB-CF518233BRJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:O31442
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYS LVSLALSYITLIVVRKRKESGN
Protein Names:Recommended name: Uncharacterized protein ybeF
Gene Names:Name:ybeF Ordered Locus Names:BSU02150
Expression Region:1-82
Sequence Info:full length protein
