Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Uncharacterized membrane protein ylmG(ylmG)

Recombinant Bacillus subtilis Uncharacterized membrane protein ylmG(ylmG)

SKU:CSB-CF518284BRJ

Regular price £1,171.00 GBP
Regular price Sale price £1,171.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O31729

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MILYQVFSVLSLLITIYSFALIIYIFMSWVPSTRETAVGRFLASICEPYLEPFRKIIPPI AMLDISPIVAILVLRFATTGLWGLYRMIAF

Protein Names:Recommended name: Uncharacterized membrane protein ylmG

Gene Names:Name:ylmG Ordered Locus Names:BSU15400

Expression Region:1-90

Sequence Info:full length protein

View full details