Gene Bio Systems
Recombinant Bacillus subtilis Quinol oxidase subunit 3(qoxC)
Recombinant Bacillus subtilis Quinol oxidase subunit 3(qoxC)
SKU:CSB-CF339514BRJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:P34958
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEHAEHGNSNAPMEYQSETGRLNILGFWIFLGAEIVLFSTLFATFFVLKNRTAGGVLPDE LFEVNLVMIMTFLLLISSFTCGIAVHEMRRGSLKGVVIWTIITLLLGAGFVGCEINEFVH YVHEGAALSTSAFWSGFFVLLGTHGTHVTIGIFWITGILIQLKKRGLTPQTSSKIFISSL YWHFLDVVWIFIFTGVYLMGLGGL
Protein Names:Recommended name: Quinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Oxidase aa(3)-600 subunit 3 Quinol oxidase aa3-600, subunit QoxC Quinol oxidase polypeptide III
Gene Names:Name:qoxC Ordered Locus Names:BSU38150 ORF Names:ipa-39d
Expression Region:1-204
Sequence Info:full length protein
