Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Probable peptide export permease protein yydJ(yydJ)

Recombinant Bacillus subtilis Probable peptide export permease protein yydJ(yydJ)

SKU:CSB-CF671559BRJ

Regular price £1,318.00 GBP
Regular price Sale price £1,318.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:Q45592

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLEFKKSISNKVIIILGAMFVFLFLLGYFLLVGIDKVSNVTPEMFFFSSYTVATQFGLM LFSFVIAFFINREYSNKNILFYKLIGENIYTFFYKKIAVLFLECFAFITLGLLIISLMYH DFSHFALLLFLFSAVILQYILIIGTISVLCPNILISIGVSIVYWMTSVILVAISNKTFGF IAPFEAGNTMYPRIERVLQSDNMTLGSNDVLFIILYLVSIIIINAIVLRFSKTRWIKMGL

Protein Names:Recommended name: Probable peptide export permease protein yydJ

Gene Names:Name:yydJ Ordered Locus Names:BSU40140

Expression Region:1-240

Sequence Info:full length protein

View full details