Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Na(+)-H(+) antiporter subunit C

Recombinant Bacillus subtilis Na(+)-H(+) antiporter subunit C

SKU:CSB-CF517351BRJ

Regular price £1,086.00 GBP
Regular price Sale price £1,086.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O05260

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEILMAVLAGIIFMAATYLLLSKSLLRVIIGTALLSHGVHLMLLTMGGLKKGAAPILSEH AKSFVDPLPQALILTAIVISFGVTSFILVMAFRAYQELKSDDMDQMRGNDQHE

Protein Names:Recommended name: Na(+)/H(+) antiporter subunit C Alternative name(s): Mrp complex subunit C Multiple resistance and pH homeostasis protein C

Gene Names:Name:mrpC Synonyms:yufV Ordered Locus Names:BSU31620

Expression Region:1-113

Sequence Info:full length protein

View full details