Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Immunity protein sdpI(sdpI)

Recombinant Bacillus subtilis Immunity protein sdpI(sdpI)

SKU:CSB-CF518376BRJ

Regular price £1,272.00 GBP
Regular price Sale price £1,272.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O32241

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKNIISIIIVCLSFLTSIILYQYLPEEIPIQWSGNKPAAIVSKPLTIFIIPVVMLIYYL TFYMLTIKSTQKNKALLFLASNNMLILLYILQLSTLLISLGYEVNIDLIIGLGVGIFLII GGNSMQLAEQNHLIGLRTPWTLKDETVWKLGNRFASKVLVVCGFIIAVLSFFTGEYIILI MIVLVLLALVISTLASYHYYKKLNGSR

Protein Names:Recommended name: Immunity protein sdpI

Gene Names:Name:sdpI Synonyms:yvaZ Ordered Locus Names:BSU33780

Expression Region:1-207

Sequence Info:full length protein

View full details