Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus selenitireducens Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

Recombinant Bacillus selenitireducens Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

SKU:CSB-CF516699BRD

Regular price £1,325.00 GBP
Regular price Sale price £1,325.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus selenitireducens (strain ATCC 700615 / DSM 15326 / MLS10)

Uniprot NO.:D6XVS2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFDSIIIGQYVPGDSVVHRLDPRVKLTAVFIFLVFMFMTRDPLLLTVAVLLSFGGLLASR VPLSFYAKGMRFISIIIVLTFVLHLFMTGGGEVIVELPFATIYSGGLIEGFMLAMKLAMI ITIASLLTLTTTPIDLTDGMERMLAPFKRVKLPTHELALMMSIALRFIPTLIEETRTIVL AQLARGTNFSEGSLWKRLKALIPILVPLFTQSFKRAEELATAMEARGYAGGEGRTKYRQL HWGLKDSVVLAVFLLFAAAVMAERFMGG

Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein EcfT Short name= ECF transporter T component EcfT

Gene Names:Name:ecfT Ordered Locus Names:Bsel_0146

Expression Region:1-268

Sequence Info:full length protein

View full details