Gene Bio Systems
Recombinant Bacillus pseudofirmus Uncharacterized protein BpOF4_21044(BpOF4_21044)
Recombinant Bacillus pseudofirmus Uncharacterized protein BpOF4_21044(BpOF4_21044)
SKU:CSB-CF669323BRB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus pseudofirmus (strain OF4)
Uniprot NO.:Q45130
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNEIFKELEGDCMGENVQLKDVIFNDSKYSKTKKVLAIMFITFVFLLQVNGTDKMIGFIF VFTGTVIGVTYSVCKLLFYNTKRYIKDIVFLIIFVCLFVWGIITFFNL
Protein Names:Recommended name: Uncharacterized protein BpOF4_21044 Alternative name(s): ORFB
Gene Names:Ordered Locus Names:BpOF4_21044
Expression Region:1-108
Sequence Info:full length protein
