Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus pseudofirmus Na(+)-H(+) antiporter subunit G(mrpG)

Recombinant Bacillus pseudofirmus Na(+)-H(+) antiporter subunit G(mrpG)

SKU:CSB-CF882654BRB

Regular price £1,092.00 GBP
Regular price Sale price £1,092.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus pseudofirmus (strain OF4)

Uniprot NO.:Q9RGY9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAVEIIISIFVLIGGFLSLLGSIGIIRFPDVYGRLHAATKSATLGVISIMLATFLFFFL VHGEFVGKLLLTILFVFLTAPVAGMMMGRSAYRVGVPLWEKSTQDDLKKMYEKKMKGSN

Protein Names:Recommended name: Na(+)/H(+) antiporter subunit G Alternative name(s): Mrp complex subunit G Multiple resistance and pH homeostasis protein G

Gene Names:Name:mrpG Ordered Locus Names:BpOF4_13180

Expression Region:1-119

Sequence Info:full length protein

View full details