Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus licheniformis UPF0316 protein BLi00691-BL01474(BLi00691, BL01474)

Recombinant Bacillus licheniformis UPF0316 protein BLi00691-BL01474(BLi00691, BL01474)

SKU:CSB-CF734287BQU

Regular price £1,258.00 GBP
Regular price Sale price £1,258.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Uniprot NO.:Q65MT6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLHSALLNGVIMVGIILVINIIYVTFLTLRMILTLKGQRYLAAFIGTIEMLVYVVGLGLV LDNLNQIQNVIAYAVGFGIGIIVGTKIEEKLALGYITVNAITKELDLDLPKQLREKGYGV THWVVGGLEGDRTAMQILTPRKYELQLYETIKSIDSKAFIISYEPKTIHGGFWVKAVKKR RIKE

Protein Names:Recommended name: UPF0316 protein BLi00691/BL01474

Gene Names:Ordered Locus Names:BLi00691, BL01474

Expression Region:1-184

Sequence Info:full length protein

View full details