Gene Bio Systems
Recombinant Bacillus clausii UPF0059 membrane protein ABC3868(ABC3868)
Recombinant Bacillus clausii UPF0059 membrane protein ABC3868(ABC3868)
SKU:CSB-CF716598BAAC
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bacillus clausii (strain KSM-K16)
Uniprot NO.:Q5WB61
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHEFVTICIMAAALGMDAFSVALGMGMLKLSGKQIFRIGLTIGLFHVAMPLAGMAVGKWL SGHFDVIATYIGGGLLLVIGVQMALNAFSDHEAEGLKPAGWGLLLFAVGVSLDSFSAGLS FGILGTEMFVTVGMIGAMSMVMSWIGLIVGSHFQKFLGAYGELLGGLVLIGFGLKIMLPL
Protein Names:Recommended name: UPF0059 membrane protein ABC3868
Gene Names:Ordered Locus Names:ABC3868
Expression Region:1-180
Sequence Info:full length protein
