Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus UPF0397 protein BCA_2731 (BCA_2731)

Recombinant Bacillus cereus UPF0397 protein BCA_2731 (BCA_2731)

SKU:CSB-CF507053BQK

Regular price £1,250.00 GBP
Regular price Sale price £1,250.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain 03BB102)

Uniprot NO.:C1EWN1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKLSTKLVVAIGIGAALYGILGLWGFSIAPNTFIKPALAILTVFGALFGPVAGLLIGLI GHTVTDTIAGWGIWWGWVISSGIIGFAMGLIQKRVGFSVKNGTYNKGDISYLAITGLIGI VIAIIFAGAFDIIVMGEPFDKIVIQVLGATIADVIVFLVLGLPITIGLAKSNKKHTQLKI EK

Protein Names:Recommended name: UPF0397 protein BCA_2731

Gene Names:Ordered Locus Names:BCA_2731

Expression Region:1-182

Sequence Info:full length protein

View full details