Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus UPF0295 protein BC_0520(BC_0520)

Recombinant Bacillus cereus UPF0295 protein BC_0520(BC_0520)

SKU:CSB-CF774045BAM

Regular price £1,223.00 GBP
Regular price Sale price £1,223.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain ATCC 14579 / DSM 31)

Uniprot NO.:Q81I77

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTIQIICPSCDKPTKMLGRVDACMHCNQPLTLDRDLEGKEFDEKYNKKSYKS

Protein Names:Recommended name: UPF0295 protein BC_0520

Gene Names:Ordered Locus Names:BC_0520

Expression Region:1-118

Sequence Info:full length protein

View full details