Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus UPF0059 membrane protein BCE33L5024(BCE33L5024)

Recombinant Bacillus cereus UPF0059 membrane protein BCE33L5024(BCE33L5024)

SKU:CSB-CF717354BAAD

Regular price £1,269.00 GBP
Regular price Sale price £1,269.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain ZK / E33L)

Uniprot NO.:Q630S4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTVITILLFGFISMLLAWTGLFIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI

Protein Names:Recommended name: UPF0059 membrane protein BCE33L5024

Gene Names:Ordered Locus Names:BCE33L5024

Expression Region:1-182

Sequence Info:full length protein

View full details