Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus Quinol oxidase subunit 2(qoxA)

Recombinant Bacillus cereus Quinol oxidase subunit 2(qoxA)

SKU:CSB-CF758495BQN

Regular price £1,321.00 GBP
Regular price Sale price £1,321.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain ATCC 10987)

Uniprot NO.:Q73DE0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LAVLNPQGPVAKAQYDLIVWSFLLMSLIIAIVFILFTVILIRYREKPENMDYEPPEQHGN TLLEIIWTLVPVIIVIALSIPTVKATYASEEVPKESKHIKPVEIYVTSANWKWLFSYPEE KIETVNYLNIPAGVPIQFKLTSVGPMNAFWVPELGGMKYTMDGMIMDLYLQADKPGSYLG RSANFSGEGFTHMEFEVEAKTKEKYDKWVKEVQQTAPKLTEDKYNEIVKPGVVGRMTFSS HHLSYVDPKSLEYCDYNYYKNKK

Protein Names:Recommended name: Quinol oxidase subunit 2 EC= 1.10.3.- Alternative name(s): Cytochrome aa(3) subunit 2 Quinol oxidase polypeptide II

Gene Names:Name:qoxA Ordered Locus Names:BCE_0772

Expression Region:29-291

Sequence Info:full length protein

View full details