Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus Antiholin-like protein LrgB(lrgB)

Recombinant Bacillus cereus Antiholin-like protein LrgB(lrgB)

SKU:CSB-CF726879BAAD

Regular price £1,295.00 GBP
Regular price Sale price £1,295.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain ZK / E33L)

Uniprot NO.:Q630G4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASTMTPYFGIVVSLIAYGIGTLLFKHSKGFFLFTPLFVAMVLGIVFLKVGNFTFEEYNT GGKMISFFLEPATIAFAIPLYKQVDKLKKYWWQILSAIVVGSICSVIVVFIVAKAIGLDT AVMNSMLPQAATTAIALPISESIGGIPAITSFAVIFNAVIVYALGALFLKTFRVKHPIAK GLALGTAGHALGVAVGIEMGEVEAAMASIAVTVVGVVTVVVIPMFMPFIG

Protein Names:Recommended name: Antiholin-like protein LrgB

Gene Names:Name:lrgB Ordered Locus Names:BCE33L5135

Expression Region:1-230

Sequence Info:full length protein

View full details