Gene Bio Systems
Recombinant Bacillus anthracis UPF0295 protein BAMEG_4067 (BAMEG_4067)
Recombinant Bacillus anthracis UPF0295 protein BAMEG_4067 (BAMEG_4067)
SKU:CSB-CF501692BQG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus anthracis (strain CDC 684 / NRRL 3495)
Uniprot NO.:C3LH93
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS
Protein Names:Recommended name: UPF0295 protein BAMEG_4067
Gene Names:Ordered Locus Names:BAMEG_4067
Expression Region:1-118
Sequence Info:full length protein
