Gene Bio Systems
Recombinant Bacillus amyloliquefaciens UPF0295 protein RBAM_008830 (RBAM_008830)
Recombinant Bacillus amyloliquefaciens UPF0295 protein RBAM_008830 (RBAM_008830)
SKU:CSB-CF421845BQD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus amyloliquefaciens (strain FZB42)
Uniprot NO.:A7Z2P1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKYSSKINKIRTFALSLVFVGFIIMYIGLFFKQSVLLASLFMILGLLSIGLSTAVYFWI GMLSTKAVRVMCPACEKETKILGRVDMCMHCREPLTLDKGLEGKAFDESYNRKNSVK
Protein Names:Recommended name: UPF0295 protein RBAM_008830
Gene Names:Ordered Locus Names:RBAM_008830
Expression Region:1-117
Sequence Info:full length protein
